Support Vector Machine GPCR Subfamily Classification Results for Affy.ctg14797-000001.1.0

>Affy.ctg14797-000001.1.0 MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQV YMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFF RCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDN QTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTA AFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV



Here is a list of Class A Rhodopsin like subfamilies with support vector machine models and the score this sequence received with respect to each model.

-0.0020906911Class A Orphan/other
 -0.001362402GPR
 -0.0030481801yet even more Class A Orphans
 -0.9323094Mas proto-oncogene
 -1.0188628Chemokine receptor-like 2
 -1.0855892GP40 like
 -1.136814RDC1
 -1.1721387SREB
 -1.1827321ORPH
 -1.2009197Adrenomedullin (G10D)
 -1.2084569GPR37 like (peptide receptor)
 -1.2894485BONZO
-0.16034201Peptide
-0.37001958Olfactory
-0.4686566Nucleotide-like
-0.642135Amine
-0.99117637Platelet activating factor
-0.99315107Prostanoid
-1.000729Gonadotropin-releasing hormone
-1.0286651Viral
-1.0307153Thyrotropin-releasing hormone & Secretagogue
-1.1039839Hormone protein
-1.1789554Melatonin
-1.2481186(Rhod)opsin
-1.264238Cannabis
-1.3616111Lysosphingolipid & LPA (EDG)


View all predicted Class A Rhodopsin like peptides

HOW TO INTERPRET THE SCORES:

Subfamily Scoring:

This sequence does not appear to be in any of the subfamilies for which we have models



The support vector machine for each subfamily is trained to score positive examples (members of the subfamily) as 1.0 and negative examples (non-members) as -1.0

If this sequence receives a negative score with respect to a subfamily, it is probably not a member of the subfamily.

If this sequence receives a positive score with respect to a subfamily, it is probably in the subfamily.

In general, the score's distance from zero gives you the confidence level of the prediction. Positive scores greater than +1.0 mean a classifier has strongly accepted your sequence. Negative scores less than -1.0 mean a classifier has strongly rejected your sequence. For a more detailed evaluation of scores and confidence levels, take a look at Classification Statistics.
SOME ADDITIONAL INFORMATION:

There were 17 Class B Secretin like and 11 Class C Metabotropic glutamate / pheromone and 2 Class D Fungal pheromone and 5 Frizzled/Smoothened family and 67 Class A Rhodopsin like subfamilies whose classifiers were not run, because the families or subfamilies that contain them were rejected by classifiers higher in the hierarchy. For example, if the Amine receptor classifier scores this sequence negatively, it will not be checked with respect to the subfamilies of Amine receptors (Histamine, Serotonin, Dopamine, Octopamine and Acetylcholine (muscarinic) receptors).

Not all subfamilies have models yet. This sequence may be in a subfamily that has not yet been modeled.

Please cite: R. Karchin, K. Karplus and D. Haussler "Classifying G-Protein Coupled Receptors with Support Vector Machines" http://www.cse.ucsc.edu/research/compbio/gpcr-subclass [postscript, pdf]