Support Vector Machine GPCR Subfamily Classification Results for Affy.ctg15649-000000.1.0

>Affy.ctg15649-000000.1.0 MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL



Here is a list of Class A Rhodopsin like subfamilies with support vector machine models and the score this sequence received with respect to each model.

1.3333211 Peptide GPCRDB Peptide
  1.1230145 Interleukin-8 GPCRDB Interleukin-8
   0.96650517 Interleukin-8 type A GPCRDB Interleukin-8 type A
  -0.99189824 Interleukin-8 other
  -0.99709904 Interleukin-8 type B
 -0.953406Angiotensin
 -0.985962Fmet-leu-phe
 -0.99906796Galanin
 -1.0199269Neurotensin
 -1.0247821Chemokine
 -1.0497586Proteinase activated
 -1.0577446Chemokine/chemotactic factors like
 -1.0643207Urotensin II
 -1.0662186CCK
 -1.1064059Endothelin
 -1.1131159Bradykinin
 -1.1143141APJ like
 -1.1312772Tachykinin
 -1.1571403Melanocortin
 -1.1725398Neuropeptide Y
 -1.1810007Orexin
 -1.2315145Bombesin
 -1.2336029Somatostatin
 -1.2527244Vasopressin-like
 -1.2654269Opioid
 -1.2748014Thrombin
 -1.3143761C5a anaphylatoxin
-0.74970096Nucleotide-like
-0.91467667Viral
-0.99014866Class A Orphan/other
-0.9983312Thyrotropin-releasing hormone & Secretagogue
-1.0087326Gonadotropin-releasing hormone
-1.0585101Melatonin
-1.1225138Hormone protein
-1.1323613Prostanoid
-1.1609669(Rhod)opsin
-1.1726558Platelet activating factor
-1.177236Cannabis
-1.1912853Olfactory
-1.2740586Lysosphingolipid & LPA (EDG)
-1.3425008Amine


View all predicted Class A Rhodopsin like peptides

HOW TO INTERPRET THE SCORES:

Subfamily Scoring:

The support vector machine for each subfamily is trained to score positive examples (members of the subfamily) as 1.0 and negative examples (non-members) as -1.0

If this sequence receives a negative score with respect to a subfamily, it is probably not a member of the subfamily.

If this sequence receives a positive score with respect to a subfamily, it is probably in the subfamily.

In general, the score's distance from zero gives you the confidence level of the prediction. Positive scores greater than +1.0 mean a classifier has strongly accepted your sequence. Negative scores less than -1.0 mean a classifier has strongly rejected your sequence. For a more detailed evaluation of scores and confidence levels, take a look at Classification Statistics.
SOME ADDITIONAL INFORMATION:

There were 17 Class B Secretin like and 11 Class C Metabotropic glutamate / pheromone and 2 Class D Fungal pheromone and 5 Frizzled/Smoothened family and 80 Class A Rhodopsin like subfamilies whose classifiers were not run, because the families or subfamilies that contain them were rejected by classifiers higher in the hierarchy. For example, if the Amine receptor classifier scores this sequence negatively, it will not be checked with respect to the subfamilies of Amine receptors (Histamine, Serotonin, Dopamine, Octopamine and Acetylcholine (muscarinic) receptors).

Not all subfamilies have models yet. This sequence may be in a subfamily that has not yet been modeled.

Please cite: R. Karchin, K. Karplus and D. Haussler "Classifying G-Protein Coupled Receptors with Support Vector Machines" http://www.cse.ucsc.edu/research/compbio/gpcr-subclass [postscript, pdf]