Support Vector Machine GPCR Subfamily Classification Results for Affy.ctg17036-000000.23.0

>Affy.ctg17036-000000.23.0 MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWF LPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAK SWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCV GIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMS FCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCEL SKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRH IRRSSMSVEAETTTTFSP



Here is a list of Class A Rhodopsin like subfamilies with support vector machine models and the score this sequence received with respect to each model.

0.9969871 Peptide GPCRDB Peptide
  1.0162554 Chemokine GPCRDB Chemokine
   1.0167124 C-C Chemokine GPCRDB C-C Chemokine
    0.5916407 C-C Chemokine type 7 GPCRDB C-C Chemokine type 7
   -0.8661707 C-C Chemokine type 6
   -0.9116019 C-C Chemokine type 10
   -0.92849207 C-C Chemokine type 5
   -0.9292671 C-C Chemokine type 9
   -0.94732064 C-C Chemokine type 3
   -0.9594467 C-C Chemokine type 2
   -0.99103165 C-C Chemokine other
   -1.0163858 C-C Chemokine type 1
   -1.0435479 C-C Chemokine type 9/10
   -1.2567941 C-C Chemokine type 8
   -1.2638752 C-C Chemokine type 4
  -0.6991117 C-X-C Chemokine
  -1.1094863 XC Chemokine
  -1.1754878 C-X3-C Chemokine
 -0.90255535Interleukin-8
 -0.9625468Galanin
 -1.0127559Angiotensin
 -1.031902Chemokine/chemotactic factors like
 -1.0623851Neurotensin
 -1.0659993Proteinase activated
 -1.0797001Urotensin II
 -1.0945599Fmet-leu-phe
 -1.1261622Neuropeptide Y
 -1.1310855CCK
 -1.1311922Tachykinin
 -1.1614015Endothelin
 -1.1718968APJ like
 -1.1793662Melanocortin
 -1.185797Bradykinin
 -1.2261555Bombesin
 -1.234825Somatostatin
 -1.2535197Orexin
 -1.2754083Thrombin
 -1.2974154Opioid
 -1.342406C5a anaphylatoxin
 -1.3603641Vasopressin-like
-0.59249955Viral
-0.8207348Amine
-0.9221014Nucleotide-like
-0.99930435Class A Orphan/other
-1.0088562Gonadotropin-releasing hormone
-1.0639544Thyrotropin-releasing hormone & Secretagogue
-1.1041417Melatonin
-1.1106241Hormone protein
-1.1448746Platelet activating factor
-1.1571822(Rhod)opsin
-1.1738539Prostanoid
-1.2528344Cannabis
-1.2922133Olfactory
-1.3343503Lysosphingolipid & LPA (EDG)


View all predicted Class A Rhodopsin like peptides

HOW TO INTERPRET THE SCORES:

Subfamily Scoring:

The support vector machine for each subfamily is trained to score positive examples (members of the subfamily) as 1.0 and negative examples (non-members) as -1.0

If this sequence receives a negative score with respect to a subfamily, it is probably not a member of the subfamily.

If this sequence receives a positive score with respect to a subfamily, it is probably in the subfamily.

In general, the score's distance from zero gives you the confidence level of the prediction. Positive scores greater than +1.0 mean a classifier has strongly accepted your sequence. Negative scores less than -1.0 mean a classifier has strongly rejected your sequence. For a more detailed evaluation of scores and confidence levels, take a look at Classification Statistics.
SOME ADDITIONAL INFORMATION:

There were 17 Class B Secretin like and 11 Class C Metabotropic glutamate / pheromone and 2 Class D Fungal pheromone and 5 Frizzled/Smoothened family and 82 Class A Rhodopsin like subfamilies whose classifiers were not run, because the families or subfamilies that contain them were rejected by classifiers higher in the hierarchy. For example, if the Amine receptor classifier scores this sequence negatively, it will not be checked with respect to the subfamilies of Amine receptors (Histamine, Serotonin, Dopamine, Octopamine and Acetylcholine (muscarinic) receptors).

Not all subfamilies have models yet. This sequence may be in a subfamily that has not yet been modeled.

Please cite: R. Karchin, K. Karplus and D. Haussler "Classifying G-Protein Coupled Receptors with Support Vector Machines" http://www.cse.ucsc.edu/research/compbio/gpcr-subclass [postscript, pdf]