Support Vector Machine GPCR Subfamily Classification Results for Affy.ctg18867-000000.26.0

>Affy.ctg18867-000000.26.0 MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD AVECGGQWESQCHPPATSPLVAAQPSDT



Here is a list of Class A Rhodopsin like subfamilies with support vector machine models and the score this sequence received with respect to each model.

1.046776 Amine GPCRDB Amine
  0.9292251 Serotonin GPCRDB Serotonin
   0.912742 Serotonin Vertebrate type 4 GPCRDB Serotonin Vertebrate type 4
  -0.9806626 Serotonin Vertebrate type 6
  -1.0072964 Serotonin Vertebrate type 2
  -1.0402002 Serotonin Vertebrate type 7
  -1.0763303 Serotonin Insect type 2
  -1.1084949 Serotonin Other
  -1.1163355 Serotonin Vertebrate type 5
  -1.2636864 Serotonin Insect type 1
  -1.3280091 Serotonin Vertebrate type 1
 -0.7986707Adrenoceptors
 -0.87429565Dopamine
 -1.048995Histamine
 -1.0539856Acetylcholine (muscarinic)
 -1.3915188Octopamine
-0.99388397Gonadotropin-releasing hormone
-1.0049976Olfactory
-1.0230106Class A Orphan/other
-1.0270355Melatonin
-1.03531Nucleotide-like
-1.0643334(Rhod)opsin
-1.0650519Thyrotropin-releasing hormone & Secretagogue
-1.0706666Cannabis
-1.0740466Prostanoid
-1.109355Viral
-1.1329927Lysosphingolipid & LPA (EDG)
-1.1361Hormone protein
-1.317167Platelet activating factor
-1.4036514Peptide


View all predicted Class A Rhodopsin like peptides

HOW TO INTERPRET THE SCORES:

Subfamily Scoring:

The support vector machine for each subfamily is trained to score positive examples (members of the subfamily) as 1.0 and negative examples (non-members) as -1.0

If this sequence receives a negative score with respect to a subfamily, it is probably not a member of the subfamily.

If this sequence receives a positive score with respect to a subfamily, it is probably in the subfamily.

In general, the score's distance from zero gives you the confidence level of the prediction. Positive scores greater than +1.0 mean a classifier has strongly accepted your sequence. Negative scores less than -1.0 mean a classifier has strongly rejected your sequence. For a more detailed evaluation of scores and confidence levels, take a look at Classification Statistics.
SOME ADDITIONAL INFORMATION:

There were 17 Class B Secretin like and 11 Class C Metabotropic glutamate / pheromone and 2 Class D Fungal pheromone and 5 Frizzled/Smoothened family and 77 Class A Rhodopsin like subfamilies whose classifiers were not run, because the families or subfamilies that contain them were rejected by classifiers higher in the hierarchy. For example, if the Amine receptor classifier scores this sequence negatively, it will not be checked with respect to the subfamilies of Amine receptors (Histamine, Serotonin, Dopamine, Octopamine and Acetylcholine (muscarinic) receptors).

Not all subfamilies have models yet. This sequence may be in a subfamily that has not yet been modeled.

Please cite: R. Karchin, K. Karplus and D. Haussler "Classifying G-Protein Coupled Receptors with Support Vector Machines" http://www.cse.ucsc.edu/research/compbio/gpcr-subclass [postscript, pdf]