Support Vector Machine GPCR Subfamily Classification Results for Affy.ctg22fin4-000001.44.0

>Affy.ctg22fin4-000001.44.0 MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLL GNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVM AVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVV FSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRV WAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVA LPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEE SREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL



Here is a list of Class A Rhodopsin like subfamilies with support vector machine models and the score this sequence received with respect to each model.

1.0398369 Peptide GPCRDB Peptide
  0.96219903 Somatostatin GPCRDB Somatostatin
   0.46780992 Somatostatin type 3 GPCRDB Somatostatin type 3
  -0.84915906 Somatostatin type 5
  -1.0269687 Somatostatin type 4
  -1.0495054 Somatostatin type 2
  -1.1056225 Somatostatin type 1
 -0.77847546Galanin
 -0.9426481Angiotensin
 -0.9522955Neurotensin
 -0.998634Urotensin II
 -1.0066113Chemokine/chemotactic factors like
 -1.0108086CCK
 -1.0155814Proteinase activated
 -1.0208416Opioid
 -1.037976Fmet-leu-phe
 -1.0429759APJ like
 -1.0445094Tachykinin
 -1.0725583Melanocortin
 -1.0872186Chemokine
 -1.1183214Endothelin
 -1.1200275Neuropeptide Y
 -1.1218711Orexin
 -1.1342492Bradykinin
 -1.1449554Bombesin
 -1.2282366Interleukin-8
 -1.2495708Thrombin
 -1.264852Vasopressin-like
 -1.291545C5a anaphylatoxin
-0.6434344Nucleotide-like
-0.93565106Thyrotropin-releasing hormone & Secretagogue
-0.9363633(Rhod)opsin
-0.96152Melatonin
-0.9861514Gonadotropin-releasing hormone
-1.0040592Class A Orphan/other
-1.026056Amine
-1.0289514Prostanoid
-1.1391249Hormone protein
-1.1775044Platelet activating factor
-1.1840702Cannabis
-1.1844747Viral
-1.2093415Lysosphingolipid & LPA (EDG)
-1.2703699Olfactory


View all predicted Class A Rhodopsin like peptides

HOW TO INTERPRET THE SCORES:

Subfamily Scoring:

The support vector machine for each subfamily is trained to score positive examples (members of the subfamily) as 1.0 and negative examples (non-members) as -1.0

If this sequence receives a negative score with respect to a subfamily, it is probably not a member of the subfamily.

If this sequence receives a positive score with respect to a subfamily, it is probably in the subfamily.

In general, the score's distance from zero gives you the confidence level of the prediction. Positive scores greater than +1.0 mean a classifier has strongly accepted your sequence. Negative scores less than -1.0 mean a classifier has strongly rejected your sequence. For a more detailed evaluation of scores and confidence levels, take a look at Classification Statistics.
SOME ADDITIONAL INFORMATION:

There were 17 Class B Secretin like and 11 Class C Metabotropic glutamate / pheromone and 2 Class D Fungal pheromone and 5 Frizzled/Smoothened family and 78 Class A Rhodopsin like subfamilies whose classifiers were not run, because the families or subfamilies that contain them were rejected by classifiers higher in the hierarchy. For example, if the Amine receptor classifier scores this sequence negatively, it will not be checked with respect to the subfamilies of Amine receptors (Histamine, Serotonin, Dopamine, Octopamine and Acetylcholine (muscarinic) receptors).

Not all subfamilies have models yet. This sequence may be in a subfamily that has not yet been modeled.

Please cite: R. Karchin, K. Karplus and D. Haussler "Classifying G-Protein Coupled Receptors with Support Vector Machines" http://www.cse.ucsc.edu/research/compbio/gpcr-subclass [postscript, pdf]