Support Vector Machine GPCR Subfamily Classification Results for NP_001044

>NP_001044 MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAK MKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLA VVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGF FAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEP ASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPA HRAAANGLMQTSKL



Here is a list of Class A Rhodopsin like subfamilies with support vector machine models and the score this sequence received with respect to each model.

1.1051943 Peptide GPCRDB Peptide
  0.9534964 Somatostatin GPCRDB Somatostatin
   0.1656763 Somatostatin type 5 GPCRDB   Somatostatin type  5
  -0.81571794 Somatostatin type 3
  -0.8998225 Somatostatin type 2
  -1.0492448 Somatostatin type 1
  -1.2065713 Somatostatin type 4
 -0.7316154Galanin
 -0.9144734Tachykinin
 -0.9590808Angiotensin
 -0.9805852Neuromedin U
 -1.0123721Chemokine
 -1.0437634Urotensin II
 -1.0441334C5a anaphylatoxin
 -1.0488901CCK
 -1.0554417Thrombin
 -1.0575179Endothelin
 -1.0616922APJ like
 -1.0696504Opioid
 -1.0741946Fmet-leu-phe
 -1.1162589Bombesin
 -1.1370306Interleukin-8
 -1.141421GPR37 / endothelin B-like
 -1.1477984Melanocortin
 -1.1514738Adrenomedullin (G10D)
 -1.1650755Chemokine receptor-like
 -1.1671433Orexin & neuropeptide FF
 -1.1861215Bradykinin
 -1.2042794Vasopressin-like
 -1.2368157Neurotensin
 -1.2746003Proteinase activated
 -1.4101001Neuropeptide Y
-0.6286159Nucleotide-like
-0.84127355Thyrotropin-releasing hormone & Secretagogue
-0.9487891Class A Orphan/other
-0.9491088Gonadotropin-releasing hormone
-1.016403Melatonin
-1.0561516Prostanoid
-1.0794876Cannabis
-1.0999925Hormone protein
-1.1276671Platelet activating factor
-1.183645Olfactory
-1.1863749(Rhod)opsin
-1.2169892Viral
-1.2653615Lysosphingolipid & LPA (EDG)
-1.6938477Amine






HOW TO INTERPRET THE SCORES:

Subfamily Scoring:

The support vector machine for each subfamily is trained to score positive examples (members of the subfamily) as 1.0 and negative examples (non-members) as -1.0

If this sequence receives a negative score with respect to a subfamily, it is probably not a member of the subfamily.

If this sequence receives a positive score with respect to a subfamily, it is probably in the subfamily.

In general, the score's distance from zero gives you the confidence level of the prediction. Positive scores greater than +1.0 mean a classifier has strongly accepted your sequence. Negative scores less than -1.0 mean a classifier has strongly rejected your sequence. For a more detailed evaluation of scores and confidence levels, take a look at Classification Statistics.
SOME ADDITIONAL INFORMATION:

There were 19 Class B Secretin like and 11 Class C Metabotropic glutamate / pheromone and 2 Class D Fungal pheromone and 5 Frizzled/Smoothened family and 4 Nematode chemoreceptors and 4 Vomeronasal receptors (V1R & V3R) and 83 Class A Rhodopsin like subfamilies whose classifiers were not run, because the families or subfamilies that contain them were rejected by classifiers higher in the hierarchy. For example, if the Amine receptor classifier scores this sequence negatively, it will not be checked with respect to the subfamilies of Amine receptors (Histamine, Serotonin, Dopamine, Octopamine and Acetylcholine (muscarinic) receptors).

Not all subfamilies have models yet. This sequence may be in a subfamily that has not yet been modeled.


Please cite: R. Karchin, K. Karplus and D. Haussler "Classifying G-Protein Coupled Receptors with Support Vector Machines" Bioinformatics 2002 in press [postscript, pdf]