Support Vector Machine GPCR Subfamily Classification Results for NP_001050

>NP_001050 MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQP WANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVTNYFLVNLAFSDASMAAFNTL VNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKPRLSATATKIVIGSIWIL AFLLAFPQCLYSKTKVMPGRTLCFVQWPEGPKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIP GDTCDKYHEQLKAKRKVVKMMIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTM YNPIIYCCLNKRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS



Here is a list of Class A Rhodopsin like subfamilies with support vector machine models and the score this sequence received with respect to each model.

1.3019334 Peptide GPCRDB Peptide
  1.1122327 Tachykinin GPCRDB Tachykinin
   0.96729445 Neuromedin K (NK3) GPCRDB   Neuromedin K (NK3)
  -0.5010214 Substance P (NK1)
  -0.878498 Tachykinin like 2
  -0.97430015 Tachykinin like 1
  -0.9882441 Substance K (NK2)
 -0.7957099Neuropeptide Y
 -0.9524126Galanin
 -1.0038955Neuromedin U
 -1.0170481CCK
 -1.0515501Endothelin
 -1.065907Orexin & neuropeptide FF
 -1.0955145Bombesin
 -1.1336943Thrombin
 -1.142314Fmet-leu-phe
 -1.1459177Melanocortin
 -1.1475047GPR37 / endothelin B-like
 -1.1506296Urotensin II
 -1.1919551Angiotensin
 -1.1944386Chemokine
 -1.2044792Interleukin-8
 -1.2281566Proteinase activated
 -1.2300997Vasopressin-like
 -1.2336587Adrenomedullin (G10D)
 -1.2360349C5a anaphylatoxin
 -1.2611148APJ like
 -1.2672324Neurotensin
 -1.3173008Chemokine receptor-like
 -1.3250301Somatostatin
 -1.3433999Bradykinin
 -1.3520225Opioid
-0.8872863Thyrotropin-releasing hormone & Secretagogue
-0.8967934Hormone protein
-0.9691821Gonadotropin-releasing hormone
-1.0026016Nucleotide-like
-1.0141306Class A Orphan/other
-1.0276318Prostanoid
-1.0456253Melatonin
-1.066319Olfactory
-1.0668327(Rhod)opsin
-1.0960824Cannabis
-1.1417657Platelet activating factor
-1.1545699Viral
-1.3293626Lysosphingolipid & LPA (EDG)
-1.566592Amine






HOW TO INTERPRET THE SCORES:

Subfamily Scoring:

The support vector machine for each subfamily is trained to score positive examples (members of the subfamily) as 1.0 and negative examples (non-members) as -1.0

If this sequence receives a negative score with respect to a subfamily, it is probably not a member of the subfamily.

If this sequence receives a positive score with respect to a subfamily, it is probably in the subfamily.

In general, the score's distance from zero gives you the confidence level of the prediction. Positive scores greater than +1.0 mean a classifier has strongly accepted your sequence. Negative scores less than -1.0 mean a classifier has strongly rejected your sequence. For a more detailed evaluation of scores and confidence levels, take a look at Classification Statistics.
SOME ADDITIONAL INFORMATION:

There were 19 Class B Secretin like and 11 Class C Metabotropic glutamate / pheromone and 2 Class D Fungal pheromone and 5 Frizzled/Smoothened family and 4 Nematode chemoreceptors and 4 Vomeronasal receptors (V1R & V3R) and 83 Class A Rhodopsin like subfamilies whose classifiers were not run, because the families or subfamilies that contain them were rejected by classifiers higher in the hierarchy. For example, if the Amine receptor classifier scores this sequence negatively, it will not be checked with respect to the subfamilies of Amine receptors (Histamine, Serotonin, Dopamine, Octopamine and Acetylcholine (muscarinic) receptors).

Not all subfamilies have models yet. This sequence may be in a subfamily that has not yet been modeled.


Please cite: R. Karchin, K. Karplus and D. Haussler "Classifying G-Protein Coupled Receptors with Support Vector Machines" Bioinformatics 2002 in press [postscript, pdf]