Support Vector Machine GPCR Subfamily Classification Results for NP_001471

>NP_001471 MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVTLVVFGLIFALGVLGNSLVITVLARSKPGKPRSTT NLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSMLVSIFTLAAMSVDRYVAIVHS RRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHPRASNQTFCWEQWPDPRHKKAYVVCTFVFGYL LPLLLICFCYAKVLNHLHKKLKNMSKKSEASKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPA SFLFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKENKSRIDTPPSTNCTHV



Here is a list of Class A Rhodopsin like subfamilies with support vector machine models and the score this sequence received with respect to each model.

1.0936952 Peptide GPCRDB Peptide
  1.0665734 Galanin GPCRDB Galanin
  0.17772774 Chemokine GPCRDB Chemokine
  -1.1145912 C-X-C Chemokine
  -1.160441 C-C Chemokine
  -1.2002385 XC Chemokine
  -1.2034781 C-X3-C Chemokine
 -0.86238015Neuropeptide Y
 -0.9421718Tachykinin
 -1.0276364Endothelin
 -1.0330927Bombesin
 -1.0546067CCK
 -1.0682461Neuromedin U
 -1.0887234Orexin & neuropeptide FF
 -1.1113946Angiotensin
 -1.1129013Urotensin II
 -1.1236355Thrombin
 -1.1394236GPR37 / endothelin B-like
 -1.1398622Fmet-leu-phe
 -1.1410582Melanocortin
 -1.1553869C5a anaphylatoxin
 -1.1659625Vasopressin-like
 -1.1725086Adrenomedullin (G10D)
 -1.180868APJ like
 -1.203082Interleukin-8
 -1.2323539Neurotensin
 -1.2562618Proteinase activated
 -1.2839222Opioid
 -1.2873014Bradykinin
 -1.3107789Chemokine receptor-like
 -1.3131247Somatostatin
-0.8618773(Rhod)opsin
-0.9520313Nucleotide-like
-0.95212215Gonadotropin-releasing hormone
-0.95725006Prostanoid
-0.9941775Class A Orphan/other
-0.9959194Olfactory
-0.9993989Thyrotropin-releasing hormone & Secretagogue
-1.0019531Melatonin
-1.0086219Amine
-1.053754Hormone protein
-1.0604252Platelet activating factor
-1.0952076Cannabis
-1.2849845Viral
-1.334614Lysosphingolipid & LPA (EDG)




HOW TO INTERPRET THE SCORES:

Subfamily Scoring:

The support vector machine for each subfamily is trained to score positive examples (members of the subfamily) as 1.0 and negative examples (non-members) as -1.0

If this sequence receives a negative score with respect to a subfamily, it is probably not a member of the subfamily.

If this sequence receives a positive score with respect to a subfamily, it is probably in the subfamily.

In general, the score's distance from zero gives you the confidence level of the prediction. Positive scores greater than +1.0 mean a classifier has strongly accepted your sequence. Negative scores less than -1.0 mean a classifier has strongly rejected your sequence. For a more detailed evaluation of scores and confidence levels, take a look at Classification Statistics.
SOME ADDITIONAL INFORMATION:

There were 19 Class B Secretin like and 11 Class C Metabotropic glutamate / pheromone and 2 Class D Fungal pheromone and 5 Frizzled/Smoothened family and 4 Nematode chemoreceptors and 4 Vomeronasal receptors (V1R & V3R) and 101 Class A Rhodopsin like subfamilies whose classifiers were not run, because the families or subfamilies that contain them were rejected by classifiers higher in the hierarchy. For example, if the Amine receptor classifier scores this sequence negatively, it will not be checked with respect to the subfamilies of Amine receptors (Histamine, Serotonin, Dopamine, Octopamine and Acetylcholine (muscarinic) receptors).

Not all subfamilies have models yet. This sequence may be in a subfamily that has not yet been modeled.

Please cite: R. Karchin, K. Karplus and D. Haussler "Classifying G-Protein Coupled Receptors with Support Vector Machines" Bioinformatics 2002 in press [postscript, pdf]