Support Vector Machine GPCR Subfamily Classification Results for NP_062873

>NP_062873 MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGC GEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSV TDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLS ASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPR VEPDSVIALNGIVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTAR PFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD



Here is a list of Class A Rhodopsin like subfamilies with support vector machine models and the score this sequence received with respect to each model.

0.9797455 Amine GPCRDB Amine
  0.9890246 Serotonin GPCRDB Serotonin
   0.9403458 Serotonin Vertebrate type 7 GPCRDB Serotonin Vertebrate type 7
  -0.71759844 Serotonin Vertebrate type 1
  -0.9029132 Serotonin Other
  -0.9926386 Serotonin Vertebrate type 4
  -0.99557483 Serotonin Vertebrate type 5
  -1.0860505 Serotonin Vertebrate type 6
  -1.1292274 Serotonin Insect type 2
  -1.1939585 Serotonin Insect type 1
  -1.2285078 Serotonin Vertebrate type 2
 -0.72006Octopamine
 -0.81824845Dopamine
 -0.96457916Acetylcholine (muscarinic)
 -1.0708411Adrenoceptors
 -1.2547009Histamine
-0.675662(Rhod)opsin
-0.995471Class A Orphan/other
-0.9987477Gonadotropin-releasing hormone
-1.0618808Cannabis
-1.0740954Prostanoid
-1.0786736Thyrotropin-releasing hormone & Secretagogue
-1.0983746Olfactory
-1.117662Hormone protein
-1.1465517Viral
-1.1481913Melatonin
-1.2358228Platelet activating factor
-1.2626435Lysosphingolipid & LPA (EDG)
-1.3177781Peptide
-1.4846281Nucleotide-like




HOW TO INTERPRET THE SCORES:

Subfamily Scoring:

The support vector machine for each subfamily is trained to score positive examples (members of the subfamily) as 1.0 and negative examples (non-members) as -1.0

If this sequence receives a negative score with respect to a subfamily, it is probably not a member of the subfamily.

If this sequence receives a positive score with respect to a subfamily, it is probably in the subfamily.

In general, the score's distance from zero gives you the confidence level of the prediction. Positive scores greater than +1.0 mean a classifier has strongly accepted your sequence. Negative scores less than -1.0 mean a classifier has strongly rejected your sequence. For a more detailed evaluation of scores and confidence levels, take a look at Classification Statistics.
SOME ADDITIONAL INFORMATION:

There were 19 Class B Secretin like and 11 Class C Metabotropic glutamate / pheromone and 2 Class D Fungal pheromone and 5 Frizzled/Smoothened family and 4 Nematode chemoreceptors and 4 Vomeronasal receptors (V1R & V3R) and 83 Class A Rhodopsin like subfamilies whose classifiers were not run, because the families or subfamilies that contain them were rejected by classifiers higher in the hierarchy. For example, if the Amine receptor classifier scores this sequence negatively, it will not be checked with respect to the subfamilies of Amine receptors (Histamine, Serotonin, Dopamine, Octopamine and Acetylcholine (muscarinic) receptors).

Not all subfamilies have models yet. This sequence may be in a subfamily that has not yet been modeled.

Please cite: R. Karchin, K. Karplus and D. Haussler "Classifying G-Protein Coupled Receptors with Support Vector Machines" Bioinformatics 2002 in press [postscript, pdf]