Support Vector Machine GPCR Subfamily Classification Results for NP_064445

>NP_064445 MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWMIFVVTASVFT NGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISIVNQVSGYFVLGHPMCVLEGYTVSLCGITG LWSLAIISWERWLVVCKPFGNVRFDAKLAIVGIAFSWIWSAVWTAPPIFGWSRYWPHGLKTSCGPDVFSG SSYPGVQSYMIVLMVTCCIIPLAIIMLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMIFAYCVC WGPYTFFACFAAANPGYAFHPLMAALPAYFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSA SKTEVSSVSSVSPA



Here is a list of Class A Rhodopsin like subfamilies with support vector machine models and the score this sequence received with respect to each model.

1.1152506 (Rhod)opsin GPCRDB (Rhod)opsin
  1.0125338 Rhodopsin Vertebrate GPCRDB   Rhodopsin Vertebrate
   1.1519855 Rhodopsin Vertebrate type 2 GPCRDB     Rhodopsin Vertebrate type 2
  -0.9573542 Rhodopsin Vertebrate type 3
  -1.0241154 Rhodopsin Vertebrate type 1
  -1.0343271 Rhodopsin Vertebrate type 5
  -1.2899439 Rhodopsin Vertebrate type 4
 -1.0547284 Rhodopsin Arthropod
 -1.0661426 Rhodopsin Other
 -1.4455228 Rhodopsin Mollusc
-1.0091126Gonadotropin-releasing hormone
-1.0369136Amine
-1.0418715Prostanoid
-1.0570588Hormone protein
-1.090766Olfactory
-1.1158532Melatonin
-1.1167853Peptide
-1.1171505Cannabis
-1.1277988Thyrotropin-releasing hormone & Secretagogue
-1.1495969Viral
-1.2029198Platelet activating factor
-1.3281114Lysosphingolipid & LPA (EDG)
-1.3731076Class A Orphan/other
-1.379555Nucleotide-like






HOW TO INTERPRET THE SCORES:

Subfamily Scoring:

The support vector machine for each subfamily is trained to score positive examples (members of the subfamily) as 1.0 and negative examples (non-members) as -1.0

If this sequence receives a negative score with respect to a subfamily, it is probably not a member of the subfamily.

If this sequence receives a positive score with respect to a subfamily, it is probably in the subfamily.

In general, the score's distance from zero gives you the confidence level of the prediction. Positive scores greater than +1.0 mean a classifier has strongly accepted your sequence. Negative scores less than -1.0 mean a classifier has strongly rejected your sequence. For a more detailed evaluation of scores and confidence levels, take a look at Classification Statistics.
SOME ADDITIONAL INFORMATION:

There were 19 Class B Secretin like and 11 Class C Metabotropic glutamate / pheromone and 2 Class D Fungal pheromone and 5 Frizzled/Smoothened family and 4 Nematode chemoreceptors and 4 Vomeronasal receptors (V1R & V3R) and 71 Class A Rhodopsin like subfamilies whose classifiers were not run, because the families or subfamilies that contain them were rejected by classifiers higher in the hierarchy. For example, if the Amine receptor classifier scores this sequence negatively, it will not be checked with respect to the subfamilies of Amine receptors (Histamine, Serotonin, Dopamine, Octopamine and Acetylcholine (muscarinic) receptors).

Not all subfamilies have models yet. This sequence may be in a subfamily that has not yet been modeled.


Please cite: R. Karchin, K. Karplus and D. Haussler "Classifying G-Protein Coupled Receptors with Support Vector Machines" Bioinformatics 2002 in press [postscript, pdf]