SOURCEHTML http://www3.ncbi.nlm.nih.gov/htbin-post/Entrez/query?uid=327742&form=6&db=n&Dopt=g
LOCUS HIVHXB2CG 9718 bp ss-RNA VRL 14-JAN-1992
DEFINITION Human immunodeficiency virus type 1 (HXB2), complete genome;
HIV1/HTLV-III/LAV reference genome.
ACCESSION K03455 M38432
NID g327742
KEYWORDS TAR protein; acquired immune deficiency syndrome; complete genome;
env protein; gag protein; long terminal repeat (LTR); pol protein;
polyprotein; proviral gene; reverse transcriptase; transactivator.
SOURCE HTLV-III/LAV (isolate HXB2) proviral DNA.
ORGANISM Human immunodeficiency virus type 1
Viruses; Retroid viruses; Retroviridae; Lentivirus; Primate
lentivirus group.
REFERENCE 1 (sites)
AUTHORS Rosen,C.A., Sodroski,J.G. and Haseltine,W.A.
TITLE The location of cis-acting regulatory sequences in the human T cell
lymphotropic virus type III (HTLV-III/LAV) long terminal repeat
JOURNAL Cell 41, 813-823 (1985)
MEDLINE 85228232
REFERENCE 2 (bases 9577 to 9718; 493 to 674)
AUTHORS Wong-Staal,F., Gallo,R.C., Chang,N.T., Ghrayeb,J., Papas,T.S.,
Lautenberger,J.A., Pearson,M.L., Petteway,S.R.Jr., Ivanoff,L.,
Baumeister,K., Whitehorn,E.A., Rafalski,J.A., Doran,E.R.,
Josephs,S.J., Starcich,B., Livak,K.J., Patarca,R., Haseltine,W.A.
and Ratner,L.
TITLE Complete nucleotide sequence of the AIDS virus, HTLV-III
JOURNAL Nature 313, 277-284 (1985)
MEDLINE 85111123
REFERENCE 3 (sites)
AUTHORS van Beveren,C.P., Coffin,J. and Hughes,S.
TITLE Appendix B: HTLV-3/LAV genome
JOURNAL (in) Weiss,R.L., Teich,N., Varmus,H. and Coffin,J. (Eds.);
RNA TUMOR VIRUSES, SECOND EDITION, 2, Vol. 2: 1102-1123;
Cold Spring Harbor Laboratory, Cold Spring Harbor (1985)
REFERENCE 4 (bases 1 to 653)
AUTHORS Starcich,B., Ratner,L., Josephs,S.F., Okamato,T., Gallo,R.C. and
Wong-Staal,F.
TITLE Characterization of long terminal repeat sequences of HTLV-III
JOURNAL Science 227, 538-540 (1985)
MEDLINE 85090465
REFERENCE 5 (sites)
AUTHORS Allan,J.S., Coligan,J.E., Barin,F., McLane,M.F., Sodroski,J.G.,
Rosen,C.A., Haseltine,W.A., Lee,T.H. and Essex,M.
TITLE Major glycoprotein antigens that induce antibodies in AIDS patients
are encoded by HTLV-III
JOURNAL Science 228, 1091-1094 (1985)
MEDLINE 85192537
REFERENCE 6 (sites)
AUTHORS Arya,S.K., Guo,C., Josephs,S.F. and Wong-Staal,F.
TITLE Trans-activator gene of human T-lymphotropic virus type III
(HTLV-III)
JOURNAL Science 229, 69-73 (1985)
MEDLINE 85244626
REFERENCE 7 (sites)
AUTHORS Sodroski,J., Patarca,R., Rosen,C., Wong-Staal,F. and Haseltine,W.A.
TITLE Location of the trans-activating region on the genome of human
T-cell lymphotropic virus type III
JOURNAL Science 229, 74-77 (1985)
MEDLINE 85244627
REFERENCE 8 (sites)
AUTHORS Rabson,A.B., Daugherty,D.F., Venkatesan,S., Boulukos,K.E.,
Benn,S.I., Folks,T.M., Feorino,P. and Martin,M.
TITLE Transcription of novel open reading frames of AIDS retrovirus
during infection of lymphocytes
JOURNAL Science 229, 1388-1390 (1985)
MEDLINE 85300515
REFERENCE 9 (sites)
AUTHORS Allan,J.S., Coligan,J.E., Lee,T.-H., McLane,M.F., Kanki,P.J.,
Groopman,J.E. and Essex,M.
TITLE A new HTLV-III/LAV encoded antigen detected by antibodies from AIDS
patients
JOURNAL Science 230, 810-813 (1985)
MEDLINE 86044509
REFERENCE 10 (sites)
AUTHORS Dayton,A.I., Sodroski,J.G., Rosen,C.A., Goh,W.C. and Haseltine,W.A.
TITLE The trans-activator gene of the human T cell lymphotropic virus
type III is required for replication
JOURNAL Cell 44, 941-947 (1986)
MEDLINE 86161683
REFERENCE 11 (sites)
AUTHORS Starcich,B.R., Hahn,B.H., Shaw,G.M., McNeely,P.D., Modrow,S.,
Wolf,H., Parks,E.S., Parks,W.P., Josephs,S.F., Gallo,R.C. and
Wong-Staal,F.
TITLE Identification and characterization of conserved and variable
regions in the envelope gene of HTLV-III/LAV, the retrovirus of
AIDS
JOURNAL Cell 45, 637-648 (1986)
MEDLINE 86218077
REFERENCE 12 (sites)
AUTHORS Feinberg,M.B., Jarret,R.F., Aldovini,A., Gallo,R.C. and
Wong-Staal,F.
TITLE HTLV-III expression and production involve complex regulation at
the levels of splicing and translation of viral RNA
JOURNAL Cell 46, 807-817 (1986)
MEDLINE 87002448
REFERENCE 13 (sites)
AUTHORS Terwilliger,E., Sodroski,J.G., Rosen,C.A. and Haseltine,W.A.
TITLE Effects of mutations within the 3' orf open reading frame region of
human T-cell lymphotropic virus type III (HTLV-III/LAV) on
replication and cytopathogenecity
JOURNAL J. Virol. 60, 754-760 (1986)
MEDLINE 87036943
REFERENCE 14 (sites)
AUTHORS Lightfoote,M.M., Coligan,J.E., Folks,T.M., Fauci,A.S., Martin,M.A.
and Venkatesan,S.
TITLE Structural characterization of reverse transcriptase and
endonuclease polypeptides of the acquired immunodeficiency syndrome
retrovirus
JOURNAL J. Virol. 60, 771-775 (1986)
MEDLINE 87036947
REFERENCE 15 (sites)
AUTHORS Rosen,C.A., Sodroski,J.G., Goh,W.C., Dayton,A.I., Lippke,J.A. and
Haseltine,W.A.
TITLE Post-transcriptional regulation accounts for the trans-activation
of the human T-lymphotropic virus type III
JOURNAL Nature 319, 555-559 (1986)
MEDLINE 86118720
REFERENCE 16 (sites)
AUTHORS Sodroski,J., Goh,W.C., Rosen,C., Dayton,A.I., Terwilliger,E. and
Haseltine,W.A.
TITLE A second post-transcriptional trans-activator gene required for
HTLV-III replication
JOURNAL Nature 321, 412-417 (1986)
MEDLINE 86230863
REFERENCE 17 (sites)
AUTHORS Arya,S.K. and Gallo,R.C.
TITLE Three novel genes of human T-lymphotropic virus type III: Immune
reactivity of their products with sera from acquired immune
deficiency syndrome patients
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 83, 2209-2213 (1986)
MEDLINE 86177573
REFERENCE 18 (sites)
AUTHORS Willey,R., Rutledge,R.A., Dias,S., Folks,T., Theodore,T.,
Buckler,C.E. and Martin,M.A.
TITLE Identification of conserved and divergent domains within the
envelope gene of the acquired immunodeficiency syndrome virus
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 83, 5038-5042 (1986)
MEDLINE 86259728
REFERENCE 19 (sites)
AUTHORS di Marzo Veronese,F., Copeland,T.D., DeVico,A.L., Rahman,R.,
Oroszlan,S., Gallo,R.C. and Sarngadharan,M.G.
TITLE Characterization of highly immunogenic p66/p51 as the reverse
transcriptase of HTLV-III/LAV
JOURNAL Science 231, 1289-1291 (1986)
MEDLINE 86122937
REFERENCE 20 (sites)
AUTHORS Lee,T.-H., Coligan,J.E., Allan,J.S., McLane,M.F., Groopman,J.E. and
Essex,M.
TITLE A new HTLV-III/LAV protein encoded by a gene found in cytopathic
retroviruses
JOURNAL Science 231, 1546-1549 (1986)
MEDLINE 86151661
REFERENCE 21 (sites)
AUTHORS Sodroski,J., Goh,W.C., Rosen,C., Tartar,A., Portetelle,D., Burny,A.
and Haseltine,W.A.
TITLE Replicative and cytopathic potential of HTLV-III/LAV with sor gene
deletions
JOURNAL Science 231, 1549-1553 (1986)
MEDLINE 86151662
REFERENCE 22 (sites)
AUTHORS Kan,N.C., Franchini,G., Wong-Staal,F., DuBois,G.C., Robey,W.G.,
Lautenberger,J.A. and Papas,T.S.
TITLE Identification of HTLV-III/LAV sor gene product and detection of
antibodies in human sera
JOURNAL Science 231, 1553-1555 (1986)
MEDLINE 86151663
REFERENCE 23 (sites)
AUTHORS Kramer,R.A., Schaber,M.D., Skalka,A.M., Ganguly,K., Wong-Staal,F.
and Reddy,P.E.
TITLE HTLV-III gag protein is processed in yeast cells by the virus
pol-protease
JOURNAL Science 231, 1580-1584 (1986)
MEDLINE 86151671
REFERENCE 24 (sites)
AUTHORS Jones,K.A., Kadonaga,J.T., Luciw,P.A. and Tjian,R.
TITLE Activation of the AIDS retrovirus promoter by the cellular
transcription factor, Sp1
JOURNAL Science 232, 755-759 (1986)
MEDLINE 86179897
REFERENCE 25 (bases 8761 to 9060)
AUTHORS Fisher,A.G., Ratner,L., Mitsuya,H., Marselle,L.M., Harper,M.E.,
Broder,S., Gallo,R.C. and Wong-Staal,F.
TITLE Infectious mutants of HTLV-III with changes in the 3' region and
markedly reduced cytopathic effects
JOURNAL Science 233, 655-659 (1986)
MEDLINE 86261824
REFERENCE 26 (sites)
AUTHORS Wright,C.M., Felber,B.K., Paskalis,H. and Pavlakis,G.N.
TITLE Expression and characterization of the trans-activator of
HTLV-III/LAV virus
JOURNAL Science 234, 988-992 (1986)
MEDLINE 87042788
REFERENCE 27 (bases )
AUTHORS Ratner,L.
JOURNAL Unpublished (1987)
REFERENCE 28 (sites)
AUTHORS Wong-Staal,F., Chanda,P.K. and Ghrayeb,J.
TITLE Human immunodeficiency virus: the eighth gene
JOURNAL AIDS Res. Hum. Retroviruses 3, 33-39 (1987)
MEDLINE 87299194
REFERENCE 29 (sites)
AUTHORS Patarca,R., Heath,C., Goldenberg,G.J., Rosen,C.A., Sodroski,J.G.,
Haseltine,W.A. and Hansen,U.M.
TITLE Transcription directed by the HIV long terminal repeat in vitro
JOURNAL AIDS Res. Hum. Retroviruses 3, 41-55 (1987)
MEDLINE 87299195
REFERENCE 30 (bases 1 to 9635; 1 to 9635)
AUTHORS Ratner,L., Fisher,A., Jagodzinski,L.L., Mitsuya,H., Liou,R.-S.,
Gallo,R.C. and Wong-Staal,F.
TITLE Complete nucleotide sequences of functional clones of the AIDS
virus
JOURNAL AIDS Res. Hum. Retroviruses 3, 57-69 (1987)
MEDLINE 87299196
REFERENCE 31 (sites)
AUTHORS Muesing,M.A., Smith,D.H. and Capon,D.J.
TITLE Regulation of mRNA accumulation by a human immunodeficiency virus
trans-activator protein
JOURNAL Cell 48, 691-701 (1987)
MEDLINE 87131081
REFERENCE 32 (sites)
AUTHORS Modrow,S., Hahn,B.H., Shaw,G.M., Gallo,R.C., Wong-Staal,F. and
Wolf,H.
TITLE Computer-assisted analysis of envelope protein sequences of seven
human immunodeficiency virus isolates: Prediction of antigenic
epitopes in conserved and variable regions
JOURNAL J. Virol. 61, 570-578 (1987)
MEDLINE 87112954
REFERENCE 33 (sites)
AUTHORS Goh,W.C., Sodroski,J.G., Rosen,C.A. and Haseltine,W.A.
TITLE Expression of the art gene protein of human T-lymphotropic virus
type III (HTLV-III/LAV) in bacteria
JOURNAL J. Virol. 61, 633-637 (1987)
MEDLINE 87112968
REFERENCE 34 (sites)
AUTHORS Nabel,G. and Baltimore,D.
TITLE An inducible transcription factor activates expression of human
immunodeficiency virus in T cells
JOURNAL Nature 326, 711-713 (1987)
MEDLINE 87173065
REFERENCE 35 (sites)
AUTHORS Fisher,A.G., Ensoli,B., Ivanoff,L., Chamberlain,M., Petteway,S.,
Ratner,L., Gallo,R.C. and Wong-Staal,F.
TITLE The sor gene of hiv-1 is required for efficient virus transmission
in vitro
JOURNAL Science 237, 888-893 (1987)
MEDLINE 87292118
REFERENCE 36 (sites)
AUTHORS Ido,E., Han,H.-p., Kezdy,F.J. and Tang,J.
TITLE Kinetic studies of human immunodeficiency virus type 1 protease and
its active-site hydrogen bond mutant A28S
JOURNAL J. Biol. Chem. 266, 24359-24366 (1991)
MEDLINE 92105089
COMMENT [6] sites; tat mRNA and other transcript boundaries. [7] sites;
tat mRNA.
[8] sites; mRNA splice sites.
[9] sites; 27K antigen cds.
[5] sites; gp160 and gp120 coding sequences.
[1] sites; regulatory sequences in the LTR.
[(in) Weiss,R., Teich,N., Varmus,H. and Coffin,J. (Eds.);RNA Tumor
Viruses, Secon] review; bases 1 to 9718.
[15] sites; trans-activator function and TAR sequence. [19]
sites; pol coding sequence.
[22] sites; 23K sor gene product.
[23] sites; pol NH2-terminal region.
[20] sites; sor 23K protein.
[21] sites; sor 23K protein.
[24] sites; Sp1 binding sites in the promoter region. [17] sites;
acceptor and donor splice sites for tat and 27K. [10] sites;
deletion mutants in the tat gene.
[18] sites; env gene conserved/varable regions; separate entries.
[16] sites; trs cds boundaries.
[12] sites; trs cds boundaries.
[11] sites; env gene conserved/variable regions; separate entries.
[26] sites; tar or transactivator target.
[13] sites; 3' orf mutations.
[14] sites; pol p34 terminus.
[31] sites; promoter, TAR, tat-III mutants.
[32] sites; envelope protein epitopes.
[33] sites; trs/art protein.
[34] sites; inducible enhancer element.
[27] revises [30].
[29] sites; long terminal repeat.
[28] sites; R orf.
[35] sites; sor.
Sequence for [25] kindly provided in computer-readable form by
L.Ratner, 19-AUG-1986.
The HXB2 sequence is being used as a reference genome for all the
HIV entries because it has been derived from a demonstrably
infectious clone. Hence not all of the 'sites' references above
were concerned with this isolate.
FEATURES Location/Qualifiers
source 1..9718
/organism="Human immunodeficiency virus type 1"
LTR 1..634
/note="5' LTR"
repeat_region 454..551
/note="R repeat 5' copy"
prim_transcript 455..9635
/note="tat, trs, 27K subgenomic mRNA"
mRNA 455..9635
/note="HXB2 genomic mRNA"
intron 743..5776
/note="tat,trs, 27K mRNA intron 1"
CDS 789..2291
/note="gag polyprotein"
/codon_start=1
/db_xref="PID:g327745"
/translation="MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERF
AVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALD
KIEEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVE
EKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPV
HAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRM
YSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTIL
KALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIVKC
FNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSYKGRPGNFLQ
SRPEPTAPPEESFRSGVETTTPPQKQEPIDKELYPLTSLRSLFGNDPSSQ"
CDS 2357..5095
/partial
/note="pol polyprotein (NH2-terminus uncertain)"
/codon_start=1
/db_xref="PID:g327746"
/translation="MSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGP
TPVNIIGRNLLTQIGCTLNFPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEIC
TEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWK
GSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRW
GLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQI
YPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAE
IQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKT
PKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDG
AANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYA
LGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSP
GIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTD
NGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKT
AVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRN
SLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED"
CDS 5040..5618
/note="sor 23K protein"
/codon_start=1
/db_xref="PID:g327747"
/translation="MENRWQVMIVWQVDRMRIRTWKSLVKHHMYVSGKARGWFYRHHY
ESPHPRISSEVHIPLGDARLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDPEL
ADQLIHLYYFDCFSDSAIRKALLGHIVSPRCEYQAGHNKVGSLQYLALAALITPKKIK
PPLPSVTKLTEDRWNKPQKTKGHRGSHTMNGH"
CDS 5558..5794
/note="R (ORF) protein"
/codon_start=1
/db_xref="PID:g327748"
/translation="MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQ
HIYETYGDTWAGVEAIIRILQQLLFIHFQNWVST"
CDS join(5830..6044,8378..8423)
/note="tat protein"
/codon_start=1
/db_xref="PID:g327743"
/translation="MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALG
ISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQSRGDPTGPKE"
exon <5830..6044
/note="tat protein, (first expressed exon)"
/number=2
CDS join(5969..6044,8378..8652)
/note="trs protein"
/codon_start=1
/db_xref="PID:g327744"
/translation="MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRR
WRERQRQIHSISERILGTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQI
LVESPTVLESGTKE"
exon <5969..6044
/note="trs protein, (first expressed exon)"
/number=2
intron 6045..8377
/note="tat, trs intron 2"
intron 6045..8377
/note="27K mRNA intron 2"
intron 6045..8377
/note="trs intron 2"
intron 6045..8377
/note="tat intron 1"
CDS 6224..8794
/note="envelope polyprotein"
/codon_start=1
/db_xref="PID:g327749"
/translation="MRVKEKYQHLWRWGWRWGTMLLGMLMICSATEKLWVTVYYGVPV
WKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFDMWKNDMVE
QMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFN
ISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYSLTSCNTSVITQACPKVSFEPIPIHYC
APAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVN
FTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNIS
RAKWNNTLKQIDSKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFN
STWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNIT
GLLLTRDGGNSNNESEIFRLGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQR
EKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLRAIEAQQHLL
QLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWN
HTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYI
KLFIMIVGGLVGLRIVFAVLSIVNRVRQGYSPLSFQTHLPIPRGPDRPEGIEEEGGER
DRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWN
LLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGACRAIRHIPRRIRQGLERILL
"
exon 8378..>8652
/note="trs protein"
/number=3
exon 8378..>8423
/note="tat protein"
/number=3
CDS 8796..9167
/note="27K protein (premature termination)"
/codon_start=1
/db_xref="PID:g327750"
/translation="MGGKWSKSSVIGWLTVRERMRRAEPAADGVGAASRDLEKHGAIT
SSNTAATNAACAWLEAQEEEEVGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIH
SQRRQDILDLWIYHTQGYFPD"
LTR 9085..9718
/note="3' LTR"
repeat_region 9539..9635
/note="R repeat 3' copy"
polyA_signal 9611..9616
/note="HXB2 mRNA polyadenyation signal"
BASE COUNT 3411 a 1773 c 2370 g 2164 t
ORIGIN 435 bp upstream of PvuII site; 5' end of proviral genome.
1 tggaagggct aattcactcc caacgaagac aagatatcct tgatctgtgg atctaccaca
61 cacaaggcta cttccctgat tagcagaact acacaccagg gccagggatc agatatccac
121 tgacctttgg atggtgctac aagctagtac cagttgagcc agagaagtta gaagaagcca
181 acaaaggaga gaacaccagc ttgttacacc ctgtgagcct gcatggaatg gatgacccgg
241 agagagaagt gttagagtgg aggtttgaca gccgcctagc atttcatcac atggcccgag
301 agctgcatcc ggagtacttc aagaactgct gacatcgagc ttgctacaag ggactttccg
361 ctggggactt tccagggagg cgtggcctgg gcgggactgg ggagtggcga gccctcagat
421 cctgcatata agcagctgct ttttgcctgt actgggtctc tctggttaga ccagatctga
481 gcctgggagc tctctggcta actagggaac ccactgctta agcctcaata aagcttgcct
541 tgagtgcttc aagtagtgtg tgcccgtctg ttgtgtgact ctggtaacta gagatccctc
601 agaccctttt agtcagtgtg gaaaatctct agcagtggcg cccgaacagg gacctgaaag
661 cgaaagggaa accagagctc tctcgacgca ggactcggct tgctgaagcg cccgcacggc
721 aagaggcgag gggcggcgac tggtgagtac gccaaaaatt ttgactagcg gaggctagaa
781 ggagagagat gggtgcgaga gcgtcagtat taagcggggg agaattagat cgatgggaaa
841 aaattcggtt aaggccaggg ggaaagaaaa aatataaatt aaaacatata gtatgggcaa
901 gcagggagct agaacgattc gcagttaatc ctggcctgtt agaaacatca gaaggctgta
961 gacaaatact gggacagcta caaccatccc ttcagacagg atcagaagaa cttagatcat
1021 tatataatac agtagcaacc ctctattgtg tgcatcaaag gatagagata aaagacacca
1081 aggaagcttt agacaagata gaggaagagc aaaacaaaag taagaaaaaa gcacagcaag
1141 cagcagctga cacaggacac agcaatcagg tcagccaaaa ttaccctata gtgcagaaca
1201 tccaggggca aatggtacat caggccatat cacctagaac tttaaatgca tgggtaaaag
1261 tagtagaaga gaaggctttc agcccagaag tgatacccat gttttcagca ttatcagaag
1321 gagccacccc acaagattta aacaccatgc taaacacagt ggggggacat caagcagcca
1381 tgcaaatgtt aaaagagacc atcaatgagg aagctgcaga atgggataga gtgcatccag
1441 tgcatgcagg gcctattgca ccaggccaga tgagagaacc aaggggaagt gacatagcag
1501 gaactactag tacccttcag gaacaaatag gatggatgac aaataatcca cctatcccag
1561 taggagaaat ttataaaaga tggataatcc tgggattaaa taaaatagta agaatgtata
1621 gccctaccag cattctggac ataagacaag gaccaaagga accctttaga gactatgtag
1681 accggttcta taaaactcta agagccgagc aagcttcaca ggaggtaaaa aattggatga
1741 cagaaacctt gttggtccaa aatgcgaacc cagattgtaa gactatttta aaagcattgg
1801 gaccagcggc tacactagaa gaaatgatga cagcatgtca gggagtagga ggacccggcc
1861 ataaggcaag agttttggct gaagcaatga gccaagtaac aaattcagct accataatga
1921 tgcagagagg caattttagg aaccaaagaa agattgttaa gtgtttcaat tgtggcaaag
1981 aagggcacac agccagaaat tgcagggccc ctaggaaaaa gggctgttgg aaatgtggaa
2041 aggaaggaca ccaaatgaaa gattgtactg agagacaggc taatttttta gggaagatct
2101 ggccttccta caagggaagg ccagggaatt ttcttcagag cagaccagag ccaacagccc
2161 caccagaaga gagcttcagg tctggggtag agacaacaac tccccctcag aagcaggagc
2221 cgatagacaa ggaactgtat cctttaactt ccctcaggtc actctttggc aacgacccct
2281 cgtcacaata aagatagggg ggcaactaaa ggaagctcta ttagatacag gagcagatga
2341 tacagtatta gaagaaatga gtttgccagg aagatggaaa ccaaaaatga tagggggaat
2401 tggaggtttt atcaaagtaa gacagtatga tcagatactc atagaaatct gtggacataa
2461 agctataggt acagtattag taggacctac acctgtcaac ataattggaa gaaatctgtt
2521 gactcagatt ggttgcactt taaattttcc cattagccct attgagactg taccagtaaa
2581 attaaagcca ggaatggatg gcccaaaagt taaacaatgg ccattgacag aagaaaaaat
2641 aaaagcatta gtagaaattt gtacagagat ggaaaaggaa gggaaaattt caaaaattgg
2701 gcctgaaaat ccatacaata ctccagtatt tgccataaag aaaaaagaca gtactaaatg
2761 gagaaaatta gtagatttca gagaacttaa taagagaact caagacttct gggaagttca
2821 attaggaata ccacatcccg cagggttaaa aaagaaaaaa tcagtaacag tactggatgt
2881 gggtgatgca tatttttcag ttcccttaga tgaagacttc aggaagtata ctgcatttac
2941 catacctagt ataaacaatg agacaccagg gattagatat cagtacaatg tgcttccaca
3001 gggatggaaa ggatcaccag caatattcca aagtagcatg acaaaaatct tagagccttt
3061 tagaaaacaa aatccagaca tagttatcta tcaatacatg gatgatttgt atgtaggatc
3121 tgacttagaa atagggcagc atagaacaaa aatagaggag ctgagacaac atctgttgag
3181 gtggggactt accacaccag acaaaaaaca tcagaaagaa cctccattcc tttggatggg
3241 ttatgaactc catcctgata aatggacagt acagcctata gtgctgccag aaaaagacag
3301 ctggactgtc aatgacatac agaagttagt ggggaaattg aattgggcaa gtcagattta
3361 cccagggatt aaagtaaggc aattatgtaa actccttaga ggaaccaaag cactaacaga
3421 agtaatacca ctaacagaag aagcagagct agaactggca gaaaacagag agattctaaa
3481 agaaccagta catggagtgt attatgaccc atcaaaagac ttaatagcag aaatacagaa
3541 gcaggggcaa ggccaatgga catatcaaat ttatcaagag ccatttaaaa atctgaaaac
3601 aggaaaatat gcaagaatga ggggtgccca cactaatgat gtaaaacaat taacagaggc
3661 agtgcaaaaa ataaccacag aaagcatagt aatatgggga aagactccta aatttaaact
3721 gcccatacaa aaggaaacat gggaaacatg gtggacagag tattggcaag ccacctggat
3781 tcctgagtgg gagtttgtta atacccctcc cttagtgaaa ttatggtacc agttagagaa
3841 agaacccata gtaggagcag aaaccttcta tgtagatggg gcagctaaca gggagactaa
3901 attaggaaaa gcaggatatg ttactaatag aggaagacaa aaagttgtca ccctaactga
3961 cacaacaaat cagaagactg agttacaagc aatttatcta gctttgcagg attcgggatt
4021 agaagtaaac atagtaacag actcacaata tgcattagga atcattcaag cacaaccaga
4081 tcaaagtgaa tcagagttag tcaatcaaat aatagagcag ttaataaaaa aggaaaaggt
4141 ctatctggca tgggtaccag cacacaaagg aattggagga aatgaacaag tagataaatt
4201 agtcagtgct ggaatcagga aagtactatt tttagatgga atagataagg cccaagatga
4261 acatgagaaa tatcacagta attggagagc aatggctagt gattttaacc tgccacctgt
4321 agtagcaaaa gaaatagtag ccagctgtga taaatgtcag ctaaaaggag aagccatgca
4381 tggacaagta gactgtagtc caggaatatg gcaactagat tgtacacatt tagaaggaaa
4441 agttatcctg gtagcagttc atgtagccag tggatatata gaagcagaag ttattccagc
4501 agaaacaggg caggaaacag catattttct tttaaaatta gcaggaagat ggccagtaaa
4561 aacaatacat actgacaatg gcagcaattt caccggtgct acggttaggg ccgcctgttg
4621 gtgggcggga atcaagcagg aatttggaat tccctacaat ccccaaagtc aaggagtagt
4681 agaatctatg aataaagaat taaagaaaat tataggacag gtaagagatc aggctgaaca
4741 tcttaagaca gcagtacaaa tggcagtatt catccacaat tttaaaagaa aaggggggat
4801 tggggggtac agtgcagggg aaagaatagt agacataata gcaacagaca tacaaactaa
4861 agaattacaa aaacaaatta caaaaattca aaattttcgg gtttattaca gggacagcag
4921 aaattcactt tggaaaggac cagcaaagct cctctggaaa ggtgaagggg cagtagtaat
4981 acaagataat agtgacataa aagtagtgcc aagaagaaaa gcaaagatca ttagggatta
5041 tggaaaacag atggcaggtg atgattgtgt ggcaagtaga caggatgagg attagaacat
5101 ggaaaagttt agtaaaacac catatgtatg tttcagggaa agctagggga tggttttata
5161 gacatcacta tgaaagccct catccaagaa taagttcaga agtacacatc ccactagggg
5221 atgctagatt ggtaataaca acatattggg gtctgcatac aggagaaaga gactggcatt
5281 tgggtcaggg agtctccata gaatggagga aaaagagata tagcacacaa gtagaccctg
5341 aactagcaga ccaactaatt catctgtatt actttgactg tttttcagac tctgctataa
5401 gaaaggcctt attaggacac atagttagcc ctaggtgtga atatcaagca ggacataaca
5461 aggtaggatc tctacaatac ttggcactag cagcattaat aacaccaaaa aagataaagc
5521 cacctttgcc tagtgttacg aaactgacag aggatagatg gaacaagccc cagaagacca
5581 agggccacag agggagccac acaatgaatg gacactagag cttttagagg agcttaagaa
5641 tgaagctgtt agacattttc ctaggatttg gctccatggc ttagggcaac atatctatga
5701 aacttatggg gatacttggg caggagtgga agccataata agaattctgc aacaactgct
5761 gtttatccat tttcagaatt gggtgtcgac atagcagaat aggcgttact cgacagagga
5821 gagcaagaaa tggagccagt agatcctaga ctagagccct ggaagcatcc aggaagtcag
5881 cctaaaactg cttgtaccaa ttgctattgt aaaaagtgtt gctttcattg ccaagtttgt
5941 ttcataacaa aagccttagg catctcctat ggcaggaaga agcggagaca gcgacgaaga
6001 gctcatcaga acagtcagac tcatcaagct tctctatcaa agcagtaagt agtacatgta
6061 acgcaaccta taccaatagt agcaatagta gcattagtag tagcaataat aatagcaata
6121 gttgtgtggt ccatagtaat catagaatat aggaaaatat taagacaaag aaaaatagac
6181 aggttaattg atagactaat agaaagagca gaagacagtg gcaatgagag tgaaggagaa
6241 atatcagcac ttgtggagat gggggtggag atggggcacc atgctccttg ggatgttgat
6301 gatctgtagt gctacagaaa aattgtgggt cacagtctat tatggggtac ctgtgtggaa
6361 ggaagcaacc accactctat tttgtgcatc agatgctaaa gcatatgata cagaggtaca
6421 taatgtttgg gccacacatg cctgtgtacc cacagacccc aacccacaag aagtagtatt
6481 ggtaaatgtg acagaaaatt ttgacatgtg gaaaaatgac atggtagaac agatgcatga
6541 ggatataatc agtttatggg atcaaagcct aaagccatgt gtaaaattaa ccccactctg
6601 tgttagttta aagtgcactg atttgaagaa tgatactaat accaatagta gtagcgggag
6661 aatgataatg gagaaaggag agataaaaaa ctgctctttc aatatcagca caagcataag
6721 aggtaaggtg cagaaagaat atgcattttt ttataaactt gatataatac caatagataa
6781 tgatactacc agctatagct tgacaagttg taacacctca gtcattacac aggcctgtcc
6841 aaaggtatcc tttgagccaa ttcccataca ttattgtgcc ccggctggtt ttgcgattct
6901 aaaatgtaat aataagacgt tcaatggaac aggaccatgt acaaatgtca gcacagtaca
6961 atgtacacat ggaattaggc cagtagtatc aactcaactg ctgttaaatg gcagtctagc
7021 agaagaagag gtagtaatta gatctgtcaa tttcacggac aatgctaaaa ccataatagt
7081 acagctgaac acatctgtag aaattaattg tacaagaccc aacaacaata caagaaaaag
7141 aatccgtatc cagagaggac cagggagagc atttgttaca ataggaaaaa taggaaatat
7201 gagacaagca cattgtaaca ttagtagagc aaaatggaat aacactttaa aacagataga
7261 tagcaaatta agagaacaat tcggaaataa taaaacaata atctttaagc aatcctcagg
7321 aggggaccca gaaattgtaa cgcacagttt taattgtgga ggggaatttt tctactgtaa
7381 ttcaacacaa ctgtttaata gtacttggtt taatagtact tggagtactg aagggtcaaa
7441 taacactgaa ggaagtgaca caatcaccct cccatgcaga ataaaacaaa ttataaacat
7501 gtggcagaaa gtaggaaaag caatgtatgc ccctcccatc agtggacaaa ttagatgttc
7561 atcaaatatt acagggctgc tattaacaag agatggtggt aatagcaaca atgagtccga
7621 gatcttcaga cttggaggag gagatatgag ggacaattgg agaagtgaat tatataaata
7681 taaagtagta aaaattgaac cattaggagt agcacccacc aaggcaaaga gaagagtggt
7741 gcagagagaa aaaagagcag tgggaatagg agctttgttc cttgggttct tgggagcagc
7801 aggaagcact atgggcgcag cctcaatgac gctgacggta caggccagac aattattgtc
7861 tggtatagtg cagcagcaga acaatttgct gagggctatt gaggcgcaac agcatctgtt
7921 gcaactcaca gtctggggca tcaagcagct ccaagcaaga atcctagctg tggaaagata
7981 cctaaaggat caacagctcc tagggatttg gggttgctct ggaaaactca tttgcaccac
8041 tgctgtgcct tggaatgcta gttggagtaa taaatctctg gaacagatct ggaatcacac
8101 gacctggatg gagtgggaca gagaaattaa caattacaca agcttaatac actccttaat
8161 tgaagaatcg caaaaccagc aagaaaagaa tgaacaagaa ttattggaat tagataaatg
8221 ggcaagtttg tggaattggt ttaacataac aaattggctg tggtatataa aattattcat
8281 aatgatagta ggaggcttgg taggtttaag aatagttttt gctgtacttt ctatagtgaa
8341 tagagttagg cagggatatt caccattatc gtttcagacc cacctcccaa tcccgagggg
8401 acccgacagg cccgaaggaa tagaagaaga aggtggagag agagacagag acagatccat
8461 tcgattagtg aacggatcct tggcacttat ctgggacgat ctgcggagcc tgtgcctctt
8521 cagctaccac cgcttgagag acttactctt gattgtaacg aggattgtgg aacttctggg
8581 acgcaggggg tgggaagccc tcaaatattg gtggaatctc ctacagtatt ggagtcagga
8641 actaaagaat agtgctgtta gcttgctcaa tgccacagcc atagcagtag ctgaggggac
8701 agatagggtt atagaagtag tacaaggagc ttgtagagct attcgccaca tacctagaag
8761 aataagacag ggcttggaaa ggattttgct ataagatggg tggcaagtgg tcaaaaagta
8821 gtgtgattgg atggcttact gtaagggaaa gaatgagacg agctgagcca gcagcagatg
8881 gggtgggagc agcatctcga gacctggaaa aacatggagc aatcacaagt agcaacacag
8941 cagctaccaa tgctgcttgt gcctggctag aagcacaaga ggaggaggag gtgggttttc
9001 cagtcacacc tcaggtacct ttaagaccaa tgacttacaa ggcagctgta gatcttagcc
9061 actttttaaa agaaaagggg ggactggaag ggctaattca ctcccaaaga agacaagata
9121 tccttgatct gtggatctac cacacacaag gctacttccc tgattgacag aactacacac
9181 cagggccagg ggtcagatat ccactgacct ttggatggtg ctacaagcta gtaccagttg
9241 agccagataa gatagaagag gccaataaag gagagaacac cagcttgtta caccctgtga
9301 gcctgcatgg gatggatgac ccggagagag aagtgttaga gtggaggttt gacagccgcc
9361 tagcatttca tcacgtggcc cgagagctgc atccggagta cttcaagaac tgctgacatc
9421 gagcttgcta caagggactt tccgctgggg actttccagg gaggcgtggc ctgggcggga
9481 ctggggagtg gcgagccctc agatcctgca tataagcagc tgctttttgc ctgtactggg
9541 tctctctggt tagaccagat ctgagcctgg gagctctctg gctaactagg gaacccactg
9601 cttaagcctc aataaagctt gccttgagtg cttcaagtag tgtgtgcccg tctgttgtgt
9661 gactctggta actagagatc cctcagaccc ttttagtcag tgtggaaaat ctctagca
//